Sermorelin 5mg
No published COA for this product · See all published COAs →
In stock · Ships within 1–2 business days by Canada Post (Express/Priority available at checkout)
About Sermorelin
Sermorelin is a synthetic peptide made up of the first 29 amino acids of growth hormone-releasing hormone (GHRH 1-29), with an amidated C-terminus. GHRH 1-29 is the shortest fragment of the 44-amino-acid hormone that retains full activity at the GHRH receptor.
Canada Research Labs supplies Sermorelin as 5mg of lyophilized powder in a 3 mL glass vial, packed and shipped from Ontario.
See the comparison GHRH analogs compared: Sermorelin, CJC-1295 and Tesamorelin.
Research background
Because it is the minimal active sequence of GHRH, Sermorelin is often used as a baseline reference in laboratory studies of GHRH receptor signaling on pituitary somatotroph cells. It is also the starting point for later analogs: CJC-1295 modifies the same 29-amino-acid sequence for greater stability, and Tesamorelin uses the full 44-amino-acid sequence with an N-terminal modification.
Researchers comparing these analogs should note that native GHRH 1-29 is broken down quickly by enzymes, which affects its behaviour in laboratory models relative to the modified versions.
What you receive
- 5mg Sermorelin as a lyophilized powder
- 3 mL glass vial, sealed
- Shipped by tracked Canada Post from Ontario, within Canada only
Testing and documentation
Every lot we sell is tested by an independent laboratory using HPLC for purity and mass spectrometry for identity. Certificates for tested lots are published in our COA library, and each can be verified directly with the lab. Our guide explains how to verify a COA.
Handling
Lyophilized peptides are generally reconstituted with bacteriostatic water, sold separately. Storage guidance is listed in the Product Information section and FAQ.
Research use only
Sermorelin is supplied strictly as a reference material for in-vitro laboratory research by qualified professionals. It is not a drug, natural health product or cosmetic, and has not been authorized by Health Canada for any human or veterinary use.
Product Information
- Molecular Formula
- C149H246N44O42S
- Molecular Weight
- 3357.88 Da
- Amount per vial
- 5mg
- Supplied as
- Lyophilized powder in a 3 mL glass vial
- Purity
- As shown in Certificate of Analysis
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Frequently asked questions
What is Sermorelin?
Sermorelin is a synthetic peptide made up of the first 29 amino acids of growth hormone-releasing hormone (GHRH 1-29), with an amidated C-terminus. GHRH 1-29 is the shortest fragment of the 44-amino-acid hormone that retains full activity at the GHRH receptor.
What does one vial contain?
5mg of Sermorelin as a lyophilized powder, supplied for in-vitro laboratory research.
How is it tested?
Every lot is tested by an independent laboratory using HPLC for purity and mass spectrometry for identity. Certificates for tested lots are published in our COA library, and each can be verified directly with the lab.
How should it be stored?
Store sealed lyophilized vials at -20°C, protected from light and moisture. Short-term storage at 2–8°C is acceptable.
How fast does it ship?
Orders ship from Ontario within 1–2 business days by Canada Post standard shipping with tracking, or by Express/Priority if you select it at checkout. Shipping is free on orders over $300 CAD. We ship within Canada only.
How do I pay?
Interac e-Transfer. Payment instructions appear on your order confirmation.
Health Canada Notice - Research Use Only
These products are for in vitro use only. They have not been evaluated or approved by Health Canada for human or veterinary use. Sold strictly as reference compounds for in-vitro laboratory research conducted by qualified professionals in a controlled research setting. Not a drug, dietary supplement, food, cosmetic, or medical device, and not intended for the diagnosis, treatment, prevention, or cure of any condition in humans or animals. Resale, redistribution, or any human or animal administration is strictly prohibited.
